- Adiponutrin/PNPLA3 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-30092
- Synthetic peptide (CVRKARSRN IGTLHPFFNI NKCIRDGLQE SLPD) corresponding to aa 73-104 mouse Adiponutrin 3
- ADPN, C22orf20, iPLA(2)epsilon
- 1.0 mg/ml
- Unconjugated
- Goat
- 0.1 mg (also 0.025 mg)
- Adiponutrin/PNPLA3
- Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin
- PBS with 1 mg/ml BSA
- Mouse
- patatin like phospholipase domain containing 3
- Novus Biologicals, a Bio-Techne Brand
- Polyclonal
- Immunogen affinity purified
- Lipid and Metabolism
- IgG
- Primary Antibodies
- Store at -80C. Avoid freeze-thaw cycles
Specifications/Features
Available conjugates: Unconjugated
Specificity: VRKARSRNIGTLHPFFNINKCIRDGLQESLPD 73-104